PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.D02410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family EIL
Protein Properties Length: 645aa    MW: 71559.1 Da    PI: 4.8246
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.D02410.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3510.57.7e-156784671354
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaa.....tgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasds 90 
                     eel++rmw+d+m+lkrl+e ++++ +d+ aa      g++k ++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+
  Pahal.D02410.1  78 EELERRMWRDRMKLKRLRELQQSRGKDQAAAgggggDGSSKPRQSQEQARRKKMSRAQDGILKYMLKMMEVCRAQGFVYGIIPEKGKPVSGASDN 172
                     8***********************999999999988889999***************************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT CS
            EIN3  91 LraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelg 185
                     LraWWkekv+fdrngpaai+kyqa+n++++ e++l + + +++hsl+elqDTtlgSLLsalmqhcdppqrr+plekgv+pPWWPtG+e+ww+elg
  Pahal.D02410.1 173 LRAWWKEKVRFDRNGPAAIAKYQADNAVPGAENELAS-GAASPHSLQELQDTTLGSLLSALMQHCDPPQRRYPLEKGVPPPWWPTGDEEWWPELG 266
                     ***********************************66.********************************************************* PP

                     --TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXX..XXXXXX CS
            EIN3 186 lskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrk..qspkvt 275
                     ++kdqg+ppykkphdlkkawkvsvLtavikhmsp+ie+ir+l+rqsk+lqdkm+ake  ++l+v++qee+++ ++++  +   s     ++ +++
  Pahal.D02410.1 267 IPKDQGPPPYKKPHDLKKAWKVSVLTAVIKHMSPDIEKIRRLVRQSKCLQDKMTAKEISTWLAVVKQEEELYLKLHPGARppaSAGGiaSAISFN 361
                     *****************************************************************************944344222242555555 PP

                     XXXXXXXXXXXXXXXX.XXXXXXXXXX............................XXXXXXXXXXXXX.XXXXXXXX......XXXXXXX.XXXX CS
            EIN3 276 lsceqkedvegkkeskikhvqavktta............................gfpvvrkrkkkps.esakvsskevsrtcqssqfrgsetel 341
                     +s++ ++dv+  +e k  ++ ++kt+                             ++++++kr +  + e++ + ++  ++tc++ ++++s+++ 
  Pahal.D02410.1 362 ASSS-EYDVDMVDECKGDEAGNQKTAVadptafnlgaamlsdkflmptpmkeetaDVEFIQKRSAAAAaEPELMLNN-RVYTCNNVHCPHSDYSY 454
                     5555.99***888888888888888779999********************************98765155666666.56*************** PP

                     XXXXXXXXXXXXX CS
            EIN3 342 ifadknsisqney 354
                     +f d+n++++++y
  Pahal.D02410.1 455 GFLDRNARNSHQY 467
                     ***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.9E-13278335No hitNo description
Gene3DG3DSA:1.10.3180.101.3E-74209343IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.09E-61214338IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MMGGGLMMDQ GMVFPGVHNF VDLLQQNGDK NLGFGSLMPQ TSSGDQCVMG EGDLVDPPPE  60
SFPDAGEDDS DDDVDDIEEL ERRMWRDRMK LKRLRELQQS RGKDQAAAGG GGGDGSSKPR  120
QSQEQARRKK MSRAQDGILK YMLKMMEVCR AQGFVYGIIP EKGKPVSGAS DNLRAWWKEK  180
VRFDRNGPAA IAKYQADNAV PGAENELASG AASPHSLQEL QDTTLGSLLS ALMQHCDPPQ  240
RRYPLEKGVP PPWWPTGDEE WWPELGIPKD QGPPPYKKPH DLKKAWKVSV LTAVIKHMSP  300
DIEKIRRLVR QSKCLQDKMT AKEISTWLAV VKQEEELYLK LHPGARPPAS AGGIASAISF  360
NASSSEYDVD MVDECKGDEA GNQKTAVADP TAFNLGAAML SDKFLMPTPM KEETADVEFI  420
QKRSAAAAAE PELMLNNRVY TCNNVHCPHS DYSYGFLDRN ARNSHQYTCK YNDPVPQSTE  480
NKPPPPPPQS QTFEGSFNQP NQALNNLDFS LPMDGQRSIA ELMNMYDNNF MTNKNMSSDS  540
VSIMERPNSL PQRMQMDDGF FGQGNGVFDD VNSMMQQPQQ APVQQQQQPA QQQFFIRDDT  600
TYGSQMGDIA GTSEFRFGSG FNMSSTVDYP GAAQQKNDGP NWYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B1e-742123431132Protein ETHYLENE INSENSITIVE 3
4zds_A1e-742123431132Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9733740.0EU973374.1 Zea mays clone 397696 ETHYLENE-INSENSITIVE3-like 1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984528.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246061e-178EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLK4A6W10.0K4A6W1_SETIT; Uncharacterized protein
STRINGSi034616m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63838168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.11e-159ETHYLENE-INSENSITIVE3-like 1